SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4FV57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4FV57
Domain Number 1 Region: 306-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000389
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 255-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000193
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4FV57
Sequence length 511
Comment (sp|A4FV57|AEBP2_BOVIN) Adipocyte enhancer-binding protein 2 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=AEBP2; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAAALTDMADLEELSRLSPLPPGSPGPAARGRAEPPEEEEEEDEEEEAEAEAVAALLLNG
GGGGGGVGGGEAETMSEPSPESASQAGEDDDEEEDDDEEEEDESSSGGGEEESSAESLVG
SSSGGSSSDETRSLSPGAASSSSGDGDGKEGLEEPKGPRGSQGGGGGGSSSSSVVSSGGD
EGYGTGGGGSSATSGGRRGSLEMSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMM
NGQGSTTSSSKNIAYNCCWDQCQACFTSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYN
TPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPK
AKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGH
SVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTAL
LLDPNIYRTMPQKRLKRTLIRKVFNLYLSKQ
Download sequence
Identical sequences A4FV57
ENSBTAP00000034344 NP_001076954.2.59421 NP_001076954.2.76553 ENSBTAP00000034344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]