SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4HLZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4HLZ2
Domain Number 1 Region: 421-472
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000000136
Family Transcriptional factor domain 0.0021
Further Details:      
 
Domain Number 2 Region: 162-242
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000458
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0028
Further Details:      
 
Domain Number 3 Region: 3-46
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000903
Family PWWP domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A4HLZ2
Sequence length 474
Comment (tr|A4HLZ2|A4HLZ2_LEIBR) Transcription elongation factor-like protein {ECO:0000313|EMBL:CAM40841.1} KW=Complete proteome; Reference proteome OX=5660 OS=Leishmania braziliensis. GN=LBRM_33_3090 OC=Leishmaniinae; Leishmania; Leishmania braziliensis species complex.
Sequence
METYAPGDRVWVYIEGDGWWPARVLSDEEMGTRTPGLDLAVQFYAGVEQPATLYELNSHA
DAANICFFETSSEKAVTGNPELEASIRHASADAEANPLKSASAMVVGTRVAAGGSGAAGN
LGAVAVNRAAAKRVRDTGDGSMGTYDGGAATSRPVSGYHHLRSEELHELSRKISSAVAAQ
DVATVRAVLCRLDSVDVYLTELEDTKIGVAVGSVLSQLELKPLWPLARAMVSFWARHLPP
ETLAAIRSVQQRQLSFPPIGASAAASATQHSSPLGKQQRVSFALPGESAFTSSVSPSVTT
TAAGAGAAVSVDSGVVASPQGKTFYDNVYQLLDSPLSTMRYDDAVIEKVARKLAAEITDR
DERQLLLLRLREEELSFIRDNLLSGEWTPKKYLDQPNEVFTTKSEKARQEQRIQEKIKAI
EAADNARLNITALFKCGRCGKRHCTFYEQQTRSADEPTTKYITCLDCKNTWIQE
Download sequence
Identical sequences A4HLZ2
XP_001568076.1.15230 psu|LbrM33_V2.3090 gi|154344264|ref|XP_001568076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]