SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4IIE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4IIE9
Domain Number 1 Region: 312-519
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.73e-66
Family Nuclear receptor ligand-binding domain 0.0000237
Further Details:      
 
Domain Number 2 Region: 112-200
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.15e-29
Family Nuclear receptor 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4IIE9
Sequence length 522
Comment (tr|A4IIE9|A4IIE9_XENTR) Nuclear receptor subfamily 1 group D member 1 {ECO:0000313|Ensembl:ENSXETP00000052764} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=nr1d1 OC=Silurana.
Sequence
MTTLDCANNTGGVISYVGSSGSSPNRTSPVSMYSDCSSGSPQSGVSHYANYLPPSPSHSY
SASSSGSGGEASPRSSYGLAASPGGLHVALDDGSRVSPSKTSSSITKLNGMVLLCKVCGD
VASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNETCSIVRINRNRCQQCRFRKCLSVG
MSRDAVRFGRIPKREKQRMLAEMHSAMNHIASGHFGRRSPIPLQPHQQQQQQLHPSSSPL
MGTAPCHSPTSLPDAYSQYPQQLTPPRSPSPEHMDDVISQVSMAHRQIFVYANDKVNKKT
SWDHPQPCWSHDTEDSHGNHNIRLACPMNALHRGGPVRSVQEVWEDFSLSFTPAVREVVE
FARHIPGFKDLTQNDQVTLLKAGTFEVLMVRFASLFDAREHSLRFLSGATYSLPELHAMG
MGELLSSMFDFSEKLSSLSLSQEELGIFTALVLVSADRSGMENSSLVEQLQETLIRALRS
LILKNSPNDTSRFTKLLLRLPDLRTLNNMHSEKLLSFRVDAH
Download sequence
Identical sequences A4IIE9
gi|134025606|gb|AAI35991| gi|154147686|ref|NP_001093675| ENSXETP00000052764 8364.ENSXETP00000052764 NP_001093675.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]