SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4IIG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4IIG7
Domain Number 1 Region: 327-589
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-71
Family Nuclear receptor ligand-binding domain 0.000000000202
Further Details:      
 
Domain Number 2 Region: 254-332
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.58e-28
Family Nuclear receptor 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A4IIG7
Sequence length 591
Comment (sp|A4IIG7|NR4A2_XENTR) Nuclear receptor subfamily 4 group A member 2 KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=nr4a2; OC=Silurana.
Sequence
MPCVQAQYGSSPQGASPASQSYTYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYNTSYDVKPPCLYQMPLSGQQSSVKVEDIQMHGYQQHGHLPPQSEEMMSHSGSV
YYKPSSPPTSSTPGFPVQHSPMWDNHGSLHSFNQNYVATRGGHVPRLSLFSFKQSPPGTP
VSSCQMRFDGHHVSMNPETSGAHHVIDGQTFAVPNPIRKQASMGFPGLQLGHASQLIDSQ
VPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPV
DKRRRNRCQYCRFQKCLVVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISA
LVRAHVDSNPAVSSLDYSRFQANPEYQMNGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGF
SELHKQDQDLLFESAFLELFVLRLAYRSNPAEGKLIFCNGVVLNRLQCVRGFGEWIDSIV
DFSSNLHSMNIDISAFSCIAALAVITERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLN
RPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences A4IIG7
NP_001093678.1.99540 ENSXETP00000011580 gi|134024482|gb|AAI36010| gi|154147678|ref|NP_001093678| gi|172044159|gb|A4IIG7| ENSXETP00000011580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]