SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4QNF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4QNF4
Domain Number 1 Region: 127-394
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.55e-70
Family Nuclear receptor ligand-binding domain 0.0000098
Further Details:      
 
Domain Number 2 Region: 71-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.77e-29
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4QNF4
Sequence length 410
Comment (tr|A4QNF4|A4QNF4_XENTR) Nr2f1 protein {ECO:0000313|EMBL:AAI35590.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=nr2f1 OC=Silurana.
Sequence
MAMVVSSWRDPQEDVAGGNPGGPNPGAREQQQAPSAAPHTPQTPSQPGPPSTPGAAGDKG
QQGSGQSQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQ
HHRNQCQYCRLKKCLKVGMRREVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLL
RAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVALLR
LTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALH
VDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLR
LPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMPIQCS
Download sequence
Identical sequences A4QNF4
gi|138519913|gb|AAI35590| gi|154147672|ref|NP_001093677| NP_001093677.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]