SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4S981 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4S981
Domain Number 1 Region: 257-338
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.22e-16
Family Chaperone J-domain 0.0018
Further Details:      
 
Domain Number 2 Region: 114-151,218-251
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000351
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4S981
Sequence length 617
Comment (tr|A4S981|A4S981_OSTLU) Uncharacterized protein {ECO:0000313|EMBL:ABP00184.1} KW=Complete proteome; Reference proteome OX=436017 OS=Ostreococcus lucimarinus (strain CCE9901). GN=OSTLU_18546 OC=Mamiellales; Bathycoccaceae; Ostreococcus.
Sequence
MEEALRKRRRLEAARRLLGVKRGNRDEDANEGRDAGDEGLDGVDSLDAYMAREVDPEVER
RRRAEATAAAEAKRRRAMEIAEAKARGERVRAREDVVMLERAEAEAEATVTPDEVIEIPS
GKVKLLIGAGGCNVKEVMRKSKAMVQVLKSEGAMNEGFSGMDIHAANAAARVATQRMLDA
ITASVAVGEDVGEEDAGEGDDVLAPKDKASNATKTKTTTDAPAMTKIMINGSEEARTMAK
RLIEELFQRAVEEKRERRGEDRERKKEQRARERRMYHLRHVADYERLEVPLGAPKDDVKS
AYRKLAVRWHPDKHPEGPARVAAAERFAVIQASYNNLMTTDEEQGMMGSIAHTSTQSKSA
KPPPNVVEARKALETRAEFERALKAQMAATEAAAARRAINIASVCLVALTAKYIKNVVDP
VTAKDLLEPIHAMRSYMAGVCVAVVAFHVISLFTLLYKTTKKGGVTPWYGFVLGGTFYMI
FIMIGQGLFAGAFHPNFAAIHDYQVSQNNPGIYGKTESDRSKALEGLSYTSAALFSVSFL
ILLFYRDTICGATVPREVASAPPPVASSTRSKSKKGAFRATQLSDNAASPSHSVVEMGER
SDGGSSLRFGADRFAAS
Download sequence
Identical sequences A4S981
jgi|Ost9901_3|18546|fgenesh1_pg.C_Chr_16000111 XP_001421890.1.19716 436017.A4S981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]