SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4SAP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4SAP6
Domain Number 1 Region: 47-237
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.68e-36
Family PAPS reductase-like 0.0062
Further Details:      
 
Domain Number 2 Region: 314-413
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.25e-17
Family PDI-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A4SAP6
Sequence length 415
Comment (tr|A4SAP6|A4SAP6_OSTLU) APS reductase {ECO:0000313|EMBL:ABP00963.1} KW=Complete proteome; Reference proteome OX=436017 OS=Ostreococcus lucimarinus (strain CCE9901). GN=OSTLU_13445 OC=Mamiellales; Bathycoccaceae; Ostreococcus.
Sequence
MRSARARGALRGPSARRAARRATTKARTTRAPSRATKADVDGMRDALERARATPLEIMDK
ALETHGDGLAIAFSGAEDVAVIQYAALTGRPYRVFSLDTGRLNPETYELFDKVEKHFDIK
IEYCFPESEAVKALVNEKGMFSFYEDGHKECCGVRKVKPLRAKLATLTAWVTGQRKDQSP
GTRNAVPACQIDPVFEGAAGGAGSLVKFNPLTDATSQEVWDFLRVMGTPVNALHERGYVS
IGCAPCTRAVLPGQQEREGRWWWEDASDKECGLHSGNLTAEEKAKQDDREATEEDIFEHD
SIRNLSRDDIAALKDEKTHGETTLAVLYAPWCPFCQRMVSGFETAAERLGPKGVKFAKFR
ADRDEKEWSQENLSMKSFPTLLLFPKGRSGYVKLGSERRDPDSLEIFIESITGKL
Download sequence
Identical sequences A4SAP6
XP_001422646.1.19716 436017.A4SAP6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]