SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4X0Z7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4X0Z7
Domain Number 1 Region: 85-302
Classification Level Classification E-value
Superfamily Prim-pol domain 9.81e-26
Family Bifunctional DNA primase/polymerase N-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A4X0Z7
Sequence length 391
Comment (tr|A4X0Z7|A4X0Z7_SALTO) Uncharacterized protein {ECO:0000313|EMBL:ABP52547.1} KW=Complete proteome; Reference proteome OX=369723 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440). GN=Strop_0062 OC=Salinispora.
Sequence
MTGGHWIGASKALGRFVSVDLPYPHICGRTVAAEDTVSGQPLQVARWEKVRYCAACAHDK
HLKAHPFTPDSRRPNPMRDATTLREVALAAALRGWHIFPLRPDDKRPAFPDHLADACTGR
DPRCRNGHTGWEARATTDPDRIRRGWSETPWGVGIACGPSGLVVIDLDVRKPDQDAPPGN
PHPAATSGIDVFAALCETAGQPIPDDTYAVTTGRGGSHLYFRHPADSPALRNTAGERGNG
LGWLVDTRAHGGYVVAAGSTVAGRSYTVARDLPVAELPGWLAERLAPAPLPPQRPVVVDL
PTGRTGAYLDAAITRQLDHLRRAAEGERNHTLYVSAVAFGQLAAGGALPADQAEALLEEA
ALSIGLSRFETLRTIRSGLTVGARRPRTVAA
Download sequence
Identical sequences A4X0Z7
gi|145592628|ref|YP_001156925.1| WP_011903984.1.3277 369723.Strop_0062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]