SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4Y3K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4Y3K0
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.75e-21
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A4Y3K0
Sequence length 147
Comment (tr|A4Y3K0|A4Y3K0_SHEPC) Uncharacterized protein {ECO:0000313|EMBL:ABP74533.1} KW=Complete proteome OX=319224 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453). GN=Sputcn32_0803 OC=Shewanellaceae; Shewanella.
Sequence
MKDELVHYISVIAKESAVAFDLSEEQLKRTEEELGAKLPHEYREAMKIDNGGEASTEEDD
WEFYPIKDISNRKRLSRTCNHIINETESCQGFGYFPESAITIAGNGFGDQMVFLKEGESF
GDTVYLWLHETGELQQLAGSFSEIKKR
Download sequence
Identical sequences A4Y3K0
319224.Sputcn32_0803 gi|146291908|ref|YP_001182332.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]