SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4Y9N7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4Y9N7
Domain Number 1 Region: 3-66,103-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000288
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A4Y9N7
Sequence length 153
Comment (tr|A4Y9N7|A4Y9N7_SHEPC) Uncharacterized protein {ECO:0000313|EMBL:ABP76670.1} KW=Complete proteome OX=319224 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453). GN=Sputcn32_2955 OC=Shewanellaceae; Shewanella.
Sequence
MKILELQIERGIELPSDYLEFVAGIDAGEDYCFNEYLDEYPEFKGRCWAFFDEELLCENI
KMSGVGNAPAHRQLELYLKCYQEFSNSEFVHSSEGKLPINRVANGFVVAEENGDLLYLDP
EDNFSVWIFHHDGSDVKKVSNSMSEWLARTTNA
Download sequence
Identical sequences A4Y9N7
gi|146294045|ref|YP_001184469.1| WP_011919829.1.82224 319224.Sputcn32_2955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]