SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4YA44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4YA44
Domain Number 1 Region: 3-66,103-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000157
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4YA44
Sequence length 153
Comment (tr|A4YA44|A4YA44_SHEPC) Uncharacterized protein {ECO:0000313|EMBL:ABP76827.1} KW=Complete proteome OX=319224 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453). GN=Sputcn32_3115 OC=Shewanellaceae; Shewanella.
Sequence
MKISELQKERGIELPSDYLEFVAGIDAGEDYCFNKFPDEYPDFEGRCWAFFDEELLCENI
EMSGVGNAPAHRQLELYLKCYREFSNSEFVHSSEGKLPINRVANGFVVAEENGDLLYLDP
EDNFSVWIFHHDGSDVKKVSNSMSEWLARTTTA
Download sequence
Identical sequences A4YA44 E6XM69
gi|146294202|ref|YP_001184626.1| WP_011919918.1.82224 WP_011919918.1.85280 319224.Sputcn32_3115 gi|386314921|ref|YP_006011086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]