SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4YAD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4YAD3
Domain Number 1 Region: 31-157
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000133
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A4YAD3
Sequence length 176
Comment (tr|A4YAD3|A4YAD3_SHEPC) Uncharacterized protein {ECO:0000313|EMBL:ABP76916.1} KW=Complete proteome OX=319224 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453). GN=Sputcn32_3204 OC=Shewanellaceae; Shewanella.
Sequence
MTLSVLNSILVPPNIPNESGIGNVWPSIDEGLSFPSDYIAFINRYGTGRIADFIAIFNPF
TTNCDLDFFEQKKSIIEDFNYLNNEDPEYFKYNLYPEINGLLPIGVTDNGDCIFWVVSDL
KDSDTWGTAIIASRSPDVEYFDENITSLLSGLLLRKIRSGSLPNSFPPKNIAFEKI
Download sequence
Identical sequences A4YAD3
2005424909 WP_011919947.1.82224 319224.Sputcn32_3204 gi|146294291|ref|YP_001184715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]