SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4YHS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4YHS5
Domain Number 1 Region: 2-175,289-367
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.23e-49
Family Bacterial dinuclear zinc exopeptidases 0.00073
Further Details:      
 
Domain Number 2 Region: 176-288
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000000001
Family Bacterial exopeptidase dimerisation domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4YHS5
Sequence length 369
Comment (tr|A4YHS5|A4YHS5_METS5) Acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase {ECO:0000313|EMBL:ABP95977.1} KW=Complete proteome; Reference proteome OX=399549 OS=15509 / TH2). GN=Msed_1823 OC=Metallosphaera.
Sequence
MNLLRELVEIETVNPPGSHYEEFTSVMRERLGELGFQVELVEIPDEFLDKNYIYSPRHRG
NKRVILLARNDPEPRLHFNFHYDVVPAGNGWVTDPFKLKVVEDRAYGRGTSDMKGAIASL
YLALSGQDFPVEVALVPDEESGGLGTRYLVDKLRVRPRHVILGEPSFPDLYVGHFGIVRG
VVRVFGKQVHASMANQGVNAFLEASRLALELQRRYSSLSLSLEGSTVLGGYVEGSTSDGM
VPGTFAFSFYRSVPPKGRGPDLDHEIVDETARELGIKHEFEIKSFVPGSMTSPDSSLTRV
VEACIREMGWEPRKEVAKIRYDAVFYGDIDAVNFGPGEPGQAHVANEYVDLRNVKRVSQV
YSCVMRSML
Download sequence
Identical sequences A0A088E6J0 A4YHS5
gi|146304585|ref|YP_001191901.1| 399549.Msed_1823 WP_012021764.1.15515 WP_012021764.1.27320 WP_012021764.1.28583 WP_012021764.1.31166 WP_012021764.1.34633 WP_012021764.1.8883 WP_012021764.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]