SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5A125 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5A125
Domain Number 1 Region: 32-94
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 1.7e-21
Family Clostridium neurotoxins, "coiled-coil" domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5A125
Sequence length 96
Comment (tr|A5A125|A5A125_CLOBO) Neurotoxin type E {ECO:0000313|EMBL:ABP58606.1} OX=1491 OS=Clostridium botulinum. GN= OC=Clostridium.
Sequence
KLNLTIQNDAYIPKYDSNGTSDIEQHDVNELNVFFYLDAQKVPEGENNVNLTSSIDTALL
EQPKIYTFFSSEFINNVNKPVQAALFVSWIQQVLVV
Download sequence
Identical sequences A5A125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]