SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5A127 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5A127
Domain Number 1 Region: 29-91
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 1.44e-21
Family Clostridium neurotoxins, "coiled-coil" domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A5A127
Sequence length 92
Comment (tr|A5A127|A5A127_CLOBO) Neurotoxin type E {ECO:0000313|EMBL:ABP58608.1} OX=1491 OS=Clostridium botulinum. GN= OC=Clostridium.
Sequence
LTIQNDAYIPKYDSNGTSDIEQHDVNELNVFFYLDAQKVPEGENNVNLTSSIDTALLEQP
KIYTFFSSEFINNVNKPVQAALFVSWIQQVLV
Download sequence
Identical sequences A5A127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]