SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5AP98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5AP98
Domain Number 1 Region: 166-242
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000012
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 2 Region: 261-293
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000275
Family CCCH zinc finger 0.0017
Further Details:      
 
Domain Number 3 Region: 100-132
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000536
Family CCCH zinc finger 0.0023
Further Details:      
 
Domain Number 4 Region: 37-62
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000072
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5AP98
Sequence length 296
Comment (tr|A5AP98|A5AP98_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CAN75883.1} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VITISV_024456 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MEVGGKRRGRPDGAAFGNGGFKKSKQETESFSTGIGSKSKPCTKFFSTSGCPFGEGCHFL
HYVPGGYSAVTQMTNLGGNPAMPPIARNPMAPPTIPDGPPTVKTRICNKFNTPEGCKFGD
KCHFAHGELELGRPIVPTHEDPRAMGPMGGRLAGRLEAPPPGLAAAASFGASATAKISVD
ASLAGAIIGKGGVNSKQICRLTGVKLSIKEHESDPNQRNIELEGTFDQIKQASAMVRELI
FNIGSAAGHAKNPTGSAASANNFKTKMCDNFAKGSCTFGDRCHFAHGANELRKPVA
Download sequence
Identical sequences A5AP98
XP_002273052.1.54126 29760.GSVIVG00003737001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]