SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5ARH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5ARH9
Domain Number 1 Region: 61-208
Classification Level Classification E-value
Superfamily PapD-like 3.14e-32
Family MSP-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A5ARH9
Sequence length 264
Comment (tr|A5ARH9|A5ARH9_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CAN60507.1} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VITISV_002788 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MGIADRRKPSSEGKLWRLCPFWQSGNGSPSSSSTQNFQQHKIRGRRHVDDTDTRSSPSKV
SSVARSFLPTRRRLRLDPANNLYFPYEPGKQVKSAVRMKNTSRSHVAFKFQTTAPKSCYM
RPPGGILAPGESIIATVFKFMEHPENNEKNEKQLDQKSNVKFKIMSLKVKAGMDYVPELF
DEQKEKVSVERILHVVFLDVERPSPALEKLKRQLAEAEAAVEARKKPPPEIGPRVIGEGL
VIDEWKERREKYLAQQQVEAVDSV
Download sequence
Identical sequences A5ARH9
XP_002284424.1.54126 29760.GSVIVG00027583001 GSVIVT01014445001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]