SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5BT38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5BT38
Domain Number 1 Region: 25-127
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.96e-30
Family Chaperone J-domain 0.00025
Further Details:      
 
Domain Number 2 Region: 242-349
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000017
Family Thioltransferase 0.029
Further Details:      
 
Weak hits

Sequence:  A5BT38
Domain Number - Region: 482-608
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000336
Family PDI-like 0.075
Further Details:      
 
Domain Number - Region: 387-460
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00254
Family Thioltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5BT38
Sequence length 617
Comment (tr|A5BT38|A5BT38_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CAN77255.1} OX=29760 OS=Vitis vinifera (Grape). GN=VITISV_035314 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MKIRGVALSIVVFALWLLIFSQAAKTLDPYKVLGVDRNASQREVQKAFHKLSLQYHPDKN
KNKGAQEKFAQINNAYEILSDEEKRKNYDMYGDERGSPGFNGGSPGFDAGNPGNNGGYTY
FTSGGPGGWQHMGGQGNSKSFSFSFGNSGGQGSSNFDLNDIFSNFFGGDKSGASHFGGFS
GSSRTQSGGFGGSSRSQSSGFSGSSRTQSGGFGGSSRSQSSGFSGTSWTQSGSGNYPKSI
QDINSQVFKKEIADQGITWLLLSYSPTLSGIQYYESIIEEVATSLQGALKAGSIYCENEP
TFCKELGIYPRKAPRVFVYSYKAIESGSLVEYKGDWATKNLKGFCQEHLPRFSKRVDLDT
FDFSSGTVERLPRVMLLSTKKDTPVIWRALSGLYRKRFIFYDVEVHDASDKVVKKLGVDA
LPAIVGWMSNGEKHVLRTGISVKDLNSAIQELSTLLNGFEKKNKKATSSQTKKPETESVD
KQIHLLTASNLDAICGETIPVCLIGVFRSSKAREKVESILSVVSQKSLSRRQNPYSGSKD
SISYTLLDATKQPAFLTAFDNSGFKSFDKLLIAYKXRKGKFAAYTSEITVEEVERFISSV
LNGDIQFTKIKQKPKLR
Download sequence
Identical sequences A5BT38

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]