SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5D2N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5D2N5
Domain Number 1 Region: 295-445
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.95e-31
Family HD domain 0.013
Further Details:      
 
Domain Number 2 Region: 187-282
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.38e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A5D2N5
Sequence length 498
Comment (sp|A5D2N5|RNY_PELTS) Ribonuclease Y {ECO:0000255|HAMAP-Rule:MF_00335} KW=Complete proteome; Reference proteome OX=370438 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI). GN=PTH_1302; OC=Pelotomaculum.
Sequence
MAFCAGYFLRKYLAEAKIASAEAQAKKILEEAEKEAEAKKREAILEAKEEVLKLRNDMER
ENRERRLELQRLERRLVQKEETLDRKVDAIEKKEDALNRKEAEIDAIKAQLNEIYKKQLS
ELERISGMTSEEAKQALLSDIEKEIQHEAAMLIKEIESKAREEGEKRARDIISLAIQRCA
ADHVAEATVSVIPLPSDEMKGRIIGREGRNIRAFETLTGIDLIIDDTPEAVILSGFDPIR
REVARIALEKLIVDGRIHPARIEEMVEKAQKEVNVQIRDAGEQAVFETGVHGLHPELVTL
LGRLKFRTSYGQNVLKHSIEVAHLAGLMASEIGVDIQMAKRAGLLHDIGKAVDHEVEGPH
VAIGIDLAKKYREAQEIIHAIAAHHGDEEPKSIIAVLVQAADAISAARPGARRETLEAYI
KRLTKLEEIANSFDGVEKSYAIQAGREVRIMVKPEKIDDLGAIRLVREITKKIENELDYP
GQIKVVIIRETRVVEYAK
Download sequence
Identical sequences A5D2N5
gi|147677637|ref|YP_001211852.1| 370438.PTH_1302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]