SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5D7A0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5D7A0
Domain Number 1 Region: 75-169
Classification Level Classification E-value
Superfamily EF-hand 2.09e-18
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5D7A0
Sequence length 242
Comment (sp|A5D7A0|EFHD2_BOVIN) Swiprosin-1 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=EFHD2; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MATDELASKLSRRLQMEGEGGGEAPEQPGLNGAAAAAAAAGAPDETAEALGSADEELSAK
LLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKEYDAGRDGFIDLMELK
LMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLHVLARLS
EIDVSTEGVKGAKSFFEAKVQAMNVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQST
FK
Download sequence
Identical sequences A5D7A0
NP_001096715.1.59421 NP_001096715.1.76553 XP_019832287.1.53367 ENSBTAP00000042244 ENSBTAP00000042244 9913.ENSBTAP00000042244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]