SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5D7S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5D7S6
Domain Number 1 Region: 113-282
Classification Level Classification E-value
Superfamily EF-hand 1.32e-43
Family Penta-EF-hand proteins 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5D7S6
Sequence length 287
Comment (tr|A5D7S6|A5D7S6_BOVIN) Penta-EF-hand domain containing 1 {ECO:0000313|Ensembl:ENSBTAP00000013699} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PEF1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MASYPYGQGCPGAGGQAPGAPPGSYYPGPPHGGGQYGSGVPPGGGYGGGPAPGGPYGPPA
GGGPYGHPHPGGLPSGTPGGPYGGAAPGGPYGTPPPNSFGAGPYGQGPPPPGGVPPNVDP
EAYSWFQSVDSDHSGYISIKELKQALVNSNWSSFNDETCLMMINMFDKTKSGRIDVYGFS
ALWKFIQQWKNLFQQYDRDCSGSISYTELQQALSQMGYNLSPQFTQLLVSRYCPRSANPA
MQLDRFIQVCTQLQVLTEAFREKDTAVQGSVRLSFEDFVTMTASRML
Download sequence
Identical sequences A5D7S6
ENSBTAP00000013699 9913.ENSBTAP00000013699 NP_001091461.1.59421 NP_001091461.1.76553 XP_019834935.1.53367 ENSBTAP00000013699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]