SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5D8L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5D8L9
Domain Number 1 Region: 38-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000669
Family Glutathione peroxidase-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5D8L9
Sequence length 228
Comment (tr|A5D8L9|A5D8L9_XENLA) LOC100049742 protein {ECO:0000313|EMBL:AAI41728.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN=LOC100049742 OC=Xenopus.
Sequence
MAAATRTPVTQQINVEEHTEEVFPAAALFHPDLELAADCLLWDRHGRSRRFGDLYRERKT
IVVFVRNFLCYTCKEYVEDLAKIPSSALEDANVRLIVIGQSSYIHIEHFCSLTGYPYEMY
VDTDRTIYSKLGMKKGETSTSSGRSPHVKSNILSGSIKSIWRAMTSPAFDFQGDPAQQGG
SLIVGPGNRVQFLHRDMNRLDQTPINSLLQHAGVQALHFGDRPVIVDV
Download sequence
Identical sequences A5D8L9
gi|146327068|gb|AAI41728| gi|148886738|ref|NP_001092155| NP_001092155.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]