SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5DI59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5DI59
Domain Number 1 Region: 158-252
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.13e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5DI59
Sequence length 253
Comment (tr|A5DI59|A5DI59_PICGU) Uncharacterized protein {ECO:0000313|EMBL:EDK38862.2} KW=Complete proteome; Reference proteome OX=294746 OS=1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii). GN=PGUG_02960 OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Meyerozyma.
Sequence
MAAPTKIQQPELPVAEKQPELPSSAPEDDSMLIDTNGVPEQEEHNATEVAGVVLDESGKP
KFAAATKVGMKVKLESRKVQVPPHRMSPLKNTWPKIYPPLVEHLKLQVRMNLKTKTVELK
TNKTTTDPGALQKGADFVKAFTLGFDVDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRA
IGRIAGKDGRTKFAIENATRTRIVLADSKIHILGGFTHIRMAREAVVSLILGSPPGKVYG
NLRTVASRMKERY
Download sequence
Identical sequences A5DI59
PGUT_02960 4929.A5DI59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]