SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5DW27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5DW27
Domain Number 1 Region: 796-901
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.41e-25
Family Pyk2-associated protein beta ARF-GAP domain 0.0012
Further Details:      
 
Domain Number 2 Region: 573-684
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-19
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 247-496,579-603
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-19
Family BAR domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5DW27
Sequence length 1016
Comment (tr|A5DW27|A5DW27_LODEL) Uncharacterized protein {ECO:0000313|EMBL:EDK43385.1} KW=Complete proteome; Reference proteome OX=379508 OS=NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus). GN=LELG_01563 OC=Candida/Lodderomyces clade; Lodderomyces.
Sequence
METISQLSFPYFEASESKVRLNKLIATDECNEQRITVSIGDDRLAHFSTRDENAIKGEDI
VKLQRPLEYTENEFAKEKTQFPLLLQLTPHCHKLKLHVSLSRPDNVESKSLLIAKSRSAT
DVLDLRNATEATSTLITNLEENSDISKIEYKDLPISKDTHGLQKLIINDTFDAKSLNGTR
LVVSLWEHDQLTGNYSYCFHFSVYISKLEQNIDTSIHNAANTKPLKNVETFNTSDTNLLK
IGDFRKEFKFDIEDGPAFRKTLSDLENAIPSAHKIYSKLIDDFKVLESNVRRMSSTKFKI
IEGINQLVDLESQSLLTELKFKESFQKAFRRLFEAFEIDINFFFDHVCASKQLVKIENSI
PALQIDNANQTELSQMKRQFESDSKEYYSWMNKYLANDKERPDSKLLAKRKVFELSKFDY
LNQLSKTTNNQYVNELCENLFQFINLGFSKSNSRVLDVKKYLDKSLKHELIGDNYQIYLH
ALTRFNSEKYQFRQKIEACQTNEELTNLIRYNTLNHMNQAAVKSQLNDAFLHSATTDEFM
VTKENFDLIFSDSIPPAEGHGTASATSSTSSSSMAIPDSDSSEMSGILFTLNGQKKQGWH
KEWVVLKNGRLIEYADWRKGKTPINKPIEVALSNVKAISHDKRQYCFEIYTSTGQRHVFQ
AFGNDDRNKWVKALYNAGQLVNKERIEQSVNTTTSSGNVANAKDKDKDKGKDKEKDKDKE
RYRERDRDRDKDSDRDKHKEEKRGMRRNVGKLVTDFALKPIIPGQHGSDRSVSPISITSK
IPIEKDHLHFVRSIPHSDNHICVDCGLFELVEWVSINSLVCMCVNCASCHRSIGSHITKI
RSLKLDKFENELEVMLGYINNRKVNEYLEFAVSASEKLQSSSDIETRLLFIRNKYAAKKY
IQLVADVDNSLIQAIQKIQVGDALKYILCGADVNINIQVKLPDTIDTQVISLFEYSLRKY
IEVDEDELRHKKLFVVSELLILNGCTNVGSEVTKLKTQQMLSNDAIDYWRNRCLKI
Download sequence
Identical sequences A5DW27
LELT_01563 36914.A5DW27 XP_001526735.1.59662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]