SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5E2X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5E2X5
Domain Number - Region: 65-197
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0178
Family IMD domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A5E2X5
Sequence length 229
Comment (tr|A5E2X5|A5E2X5_LODEL) Uncharacterized protein {ECO:0000313|EMBL:EDK45783.1} KW=Complete proteome; Reference proteome OX=379508 OS=NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus). GN=LELG_03962 OC=Candida/Lodderomyces clade; Lodderomyces.
Sequence
MGTIGIPMLAEERENLLLKLSQQTKHLVAQKKTNYKLVIGIVFNEKIRPKIQVWFDAHHR
IYKGEGRIKTLFRFGKAKARTPEEYASWLLESLDQHIEVIEGELHPENFEITTPPLSISL
TCFLNSIKASFKKVFKLFLNLSKALRIAELGQSLINAKNKKLKKPEKLKKPKKRKKRKKR
KKKTRKKKGLRPKLKDTLILMLFQMLFILLILMLFLKLFLMLPLLLLHG
Download sequence
Identical sequences A5E2X5
XP_001524930.1.59662 LELT_03962 36914.A5E2X5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]