SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5E7Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5E7Q5
Domain Number 1 Region: 33-92,129-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.56e-38
Family BAR domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5E7Q5
Sequence length 345
Comment (tr|A5E7Q5|A5E7Q5_LODEL) Uncharacterized protein {ECO:0000313|EMBL:EDK47463.1} KW=Complete proteome; Reference proteome OX=379508 OS=NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus). GN=LELG_05644 OC=Candida/Lodderomyces clade; Lodderomyces.
Sequence
MSFNFANFTKDLKSFGDRLTTDFNNEVLPLAQRTQRMVQEKIGKVNADDISQLPTEYIAL
AEKCNSIEKLYKNVLKITTNYENESYDYPLNLQESFTDFSQNITRRFSNLSKATTTAEAQ
AALIKPDETFKPPKTLYHALSRATDASVLTDGSGTGADEDYSQLASVAAGTTKSESSDPL
IKGLDLYSSSLKKIADARIGQDQLIKQKFNLPLQTTLRSLISQSNNIQRKVEQKRIDYDM
TRYNLTNCNNPAKESKLRVDMENAEDEFANTVEDAINIMQNVVENAKPLQEFLNLIQAQL
AYHKLASELLGSMVGDFENLIEEQNKLSAGSGHNQTGKESGEFEL
Download sequence
Identical sequences A5E7Q5
LELT_05644 36914.A5E7Q5 XP_001523098.1.59662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]