SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5H649 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5H649
Domain Number 1 Region: 29-331
Classification Level Classification E-value
Superfamily L domain-like 2.55e-48
Family Internalin LRR domain 0.034
Further Details:      
 
Domain Number 2 Region: 339-688
Classification Level Classification E-value
Superfamily L domain-like 1e-42
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 3 Region: 753-901
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.16e-32
Family Toll/Interleukin receptor TIR domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5H649
Sequence length 904
Comment (tr|A5H649|A5H649_BOVIN) Toll-like receptor 3 {ECO:0000313|EMBL:ABN71659.1, ECO:0000313|Ensembl:ENSBTAP00000011445} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TLR3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSRPLPYHIHFFSGLLTCWILCTSSAHKCTVRHEVADCSHLKLTQIPDDLPTNITVLNLT
HNQLRRLPPANFTRYSQLTILDGGFNSISKLEPELCQSLPWLEILNLQHNEISQLSDKTF
IFCMNLTELHLMSNSIQKIKNDPFKNLKNLIKLDLSHNGLSSTKLGTQLQLENLQELLLS
NNKISSLTPEEFDFLGNSSLKRLELSSNQIKEFSPGCFHTLGELSGLSLNNAKLSPSLTE
KLCLELSNTSIENLSLSSNQLDTISHTTFDGLKQTNLTTLDLSRNSLRVMGNDSFAWLPH
LEYLSLEYNNIEHLSSRSFYGLSNLRRLDLRRSFTRQSISLTSLPKIDDFSFQWLKCLEY
LNMDDNNFPGIKRNTFTGLVRLKFLSLSNSFSSLRTLTNETFLSLAGCPLLLLNLTKNKI
SKIQSGAFSWLGHLEVLDLGLNEIGQELTGQEWRGLDNIVEIYLSYNKYLELTTNSFTSV
PSLQRLMLRRVALKNVDCSPSPFRPLPNLVILDLSNNNIANINDELLKGLEKLEILDLQH
NNLARLWKHANPGGPVQFLKGLFHLHILNLGSNGFDEIPVEAFKDLRELKSIDLGMNNLN
ILPQSVFDNQVSLKSLSLQKNLITSVQKTVFGPAFRNLSYLDMRFNPFDCTCESIAWFVN
WINSTHTNISELSNHYLCNTPPQYHGYPVMLFDVSPCKDSAPFELLFMININILLIFIFI
VLLIHFEGWRISFYWNVSVHRVLGFKEIDRAEQFEYAAYIIHAYKDRDWVWKHFSPMEEE
DHTLRFCLEERDFEAGVLELEAIVNSIRRSRKIIFVVTQNLLKDPLCKRFKVHHAVQQAI
EQNLDSIILIFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERVNAFHHKLKVALGSR
NSAH
Download sequence
Identical sequences A5H649 A5H652
XP_005226014.1.76553 XP_010818546.1.76553 ENSBTAP00000011445 ENSBTAP00000011445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]