SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5HUL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5HUL1
Domain Number 1 Region: 30-176
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-38
Family C-type lectin domain 0.0000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5HUL1
Sequence length 188
Comment (tr|A5HUL1|A5HUL1_CHICK) C-type lectin-like receptor {ECO:0000313|EMBL:BAF62995.1} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=Blec OC=Phasianidae; Phasianinae; Gallus.
Sequence
MEEVREYPHVLGTEWSRREGPSRGACVTFQLTMAAVFTVLLITAVAFAVQAFQPHPQPCA
QCPFDWIGFRGKCYYFSEDESNWTSSQNNCSALGASLAVFDSAEDLSFTMRHKGSSPHWV
GLSREGKEHPWEWVNRSPLSHLFQVQGDGLCAYLGDAGLSSSHCSARRNWVCTKPALQKP
RKNFCIST
Download sequence
Identical sequences A5HUL1
XP_015150434.1.86415 ENSGALP00000000182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]