SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5JS94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5JS94
Domain Number 1 Region: 9-276
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.42e-50
Family Aclacinomycin methylesterase RdmC 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A5JS94
Sequence length 280
Comment (tr|A5JS94|A5JS94_ECOLX) Streptothricin acetyl transferase {ECO:0000313|EMBL:ABQ52455.1} OX=562 OS=Escherichia coli. GN=sat OC=Enterobacteriaceae; Escherichia.
Sequence
MKEKVVVDKAISLYTESFGDPAHEPIILIMGAMSSAVWWPDEFCSQLAKMGRYVIRYDHR
DTGKSTSYEPGQAPYSVEELADDVVRVIDGYGLEAAHLVGMSLGGFLSQLVALKYPKRVK
SLTLIASERLADADPDMPAFDPAIIEYHQRAESLDWSDRDAVVAYQVGAWRINSGTAHAX
DAEKIQNIAELNFDRTPNILTTFNHTTLGGGERWLGRLNEIAVPTLIIHGTEDPVLPYVH
GLALKDAIRGSKMLTLEGTGHELHHEDWPRIIQAIKGQTS
Download sequence
Identical sequences A5JS94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]