SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5K2A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5K2A2
Domain Number - Region: 20-72
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.018
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5K2A2
Sequence length 116
Comment (tr|A5K2A2|A5K2A2_PLAVS) Uncharacterized protein {ECO:0000313|EMBL:EDL46552.1} KW=Complete proteome; Reference proteome OX=126793 OS=Plasmodium vivax (strain Salvador I). GN=PVX_114455 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MPYHMEREVDCQTDAADLSEEITISEKLNGILVAYAKNMILHNPAESSEDEHVIKKKIYE
WSREYFQKLYDENGTAAKNADDGNLQAESSATRADGHSVKDQIKKEMERVNFDVGN
Download sequence
Identical sequences A0A0J9SU57 A0A0J9TBJ9 A0A0J9V1L2 A0A0J9WCS9 A0A1G4HFA6 A5K2A2
5855.PVX_114455 gi|156101171|ref|XP_001616279.1| gb|PVX_114455 XP_001616279.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]