SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5KB31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5KB31
Domain Number - Region: 107-150
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00271
Family NusA extra C-terminal domains 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A5KB31
Sequence length 245
Comment (tr|A5KB31|A5KB31_PLAVS) Uncharacterized protein {ECO:0000313|EMBL:EDL43548.1} KW=Complete proteome; Reference proteome OX=126793 OS=Plasmodium vivax (strain Salvador I). GN=PVX_098075 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MSKDFSEARSHAEHNSDGKSKVEDDLISVAGSNCSSTKSNKRSLHSRNSSVHQLLARIAQ
EIDERKPSNVIHFIVDFLCKHYPEHLHGFEAIWNGDPDLEQERILVVEFFKQQKLPVEIS
VHFVNAGFDTVETLCTLSANALDDIEKFNNTRWLPGHKVRLQQTFNDITSRVRVFKEQRD
DLIKSVKHRFVGSATPRLLNSVVLPKVASPMMLPAHQHPPFGVPRRAANYVAVDKVVRPP
YVYKR
Download sequence
Identical sequences A0A0J9SDJ0 A0A0J9TB46 A0A0J9TSY6 A0A1G4HE98 A5KB31
5855.PVX_098075 gi|156094476|ref|XP_001613275.1| XP_001613275.1.43797 gb|PVX_098075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]