SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5KC92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5KC92
Domain Number - Region: 65-121
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00602
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5KC92
Sequence length 163
Comment (tr|A5KC92|A5KC92_PLAVS) Uncharacterized protein {ECO:0000313|EMBL:EDL42956.1} KW=Complete proteome; Reference proteome OX=126793 OS=Plasmodium vivax (strain Salvador I). GN=PVX_001620 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MAVVFPKASNILRMQNFQGFSTKKVNSPIYKYCCIYYIVLQEDETPFDTQKLYNPLIGYK
YLDEIFDICNNYAEGLNIEMIKRMHEIGNLYLLPKNDKDGSTLERDNVDTPKNAYLINHS
CLHNSIALFTDLSHFISYNEHIRSGVHKCEWHYLVHTHGNFSS
Download sequence
Identical sequences A5KC92
5855.PVX_001620 XP_001612683.1.43797 gi|156093287|ref|XP_001612683.1| gb|PVX_001620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]