SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5PF46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5PF46
Domain Number 1 Region: 320-388
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.21e-17
Family PHD domain 0.0048
Further Details:      
 
Domain Number 2 Region: 211-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000717
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 273-335
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000151
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5PF46
Sequence length 400
Comment (tr|A5PF46|A5PF46_DANRE) D4, zinc and double PHD fingers family 2 {ECO:0000313|Ensembl:ENSDARP00000003264} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=dpf2 OC=Cyprinidae; Danio.
Sequence
MAAVVENVVQLLGEQYYRDALEQCHNYNARLCAERSVRMPFLDSQTGVAQSNCYFWMEKR
HRGPGVAPGQLYTYPARRWRKKRRAHPPDDPRLSFPSLKTELDLGIKKDVFSSDGSSLEA
LLKGEPVDKRSGLELRTTEEEPSSTEFSTGGLNSSSRVRKRILEPDDFLDDLDDEDYEED
TPKKRGKGKGKGRGVSSARKKLEAAAALEDRDRPYACDICGKRYKNRPGLSYHYAHSHLA
EEEGEEKDEMDIREPTPPRQDEPKTPKKGPDGLALPNNYCDFCLGDSSLNQKTGQSEELV
SCSDCGRSGHPSCLQFTPIMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYH
MYCLSPPMSVPPEGSWSCHLCLALLKEKASIFQKQNAPPL
Download sequence
Identical sequences A5PF46
ENSDARP00000003264 ENSDARP00000003264 7955.ENSDARP00000003264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]