SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5VCY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5VCY9
Domain Number 1 Region: 4-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-50
Family Ribonuclease PH domain 1-like 0.0000317
Further Details:      
 
Domain Number 2 Region: 295-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.35e-46
Family Ribonuclease PH domain 1-like 0.0000156
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.29e-28
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 4 Region: 449-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.26e-27
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 619-699
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.36e-22
Family Cold shock DNA-binding domain-like 0.00017
Further Details:      
 
Domain Number 6 Region: 553-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.22e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 7 Region: 244-320
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 5.75e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5VCY9
Sequence length 774
Comment (sp|A5VCY9|PNP_SPHWW) Polynucleotide phosphorylase {ECO:0000255|HAMAP-Rule:MF_01595} KW=Complete proteome; Reference proteome OX=392499 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273). GN=Swit_3810; OC=Sphingomonadaceae; Sphingomonas.
Sequence
MFDTKKVEIQWGGQTLTLETGRVARQADGAVLATLGETVVLCAVTAARSVKEGQDFFPLT
VHYQEKYFSSGRIPGGFFKRERGATEKETLVSRLIDRPIRPLFPEGFYNEINVIAQVLSY
DGENEPDILAMIAASAALTISGVPFMGPIGAARVGYKDGEYLLNPTDADVAAGDLDLVVA
ATHDAVMMVESEAKELSEEVMLGAVMFAHKASQDVIKAIIKLAEKSAKDPWEMAPQADLS
AAKTKLKKLVGKDITAAYKLTNKSARSSALNEARAKAKEAFADATPQDQMAAIKLVKKLE
AEIVRTAILKDGRRIDGRDTRTVRPIVAEAHFLPRAHGSALFTRGETQSISTCTLGTKES
EQMIDGLNGLRYEHFMLHYNFPPYSVGEVGRFGAPGRREVGHGKLAWRALHAVLPTKEEF
PYTIRLTSDITESNGSSSMATVCGGSLAMMDAGVPIKRPVSGIAMGLILEGKDFAVISDI
LGDEDHLGDMDFKVAGTSEGITTMQMDIKIAGITEEIFKTALLQAKEGRAHILGEMAKAL
DHTRTELSAHAPRIETMSVPKDKIRDIIGTGGKIIREIVATTGAKVDIDDDGTVKISSSD
TAQIEAARNWIIGIVAEPEVGKIYTGKVVNLVDFGAFVNFMGGKDGLVHVSEIKNERVEK
VADALSEGQEVKVKVLEIDNRGKVRLSMRVVDQETGEELPDTRPPREERPRGDRGDRGDR
GPRRDGDRRREGGDRGPRRDRGDRGDRPRRERSEGGDEGPAPDFAPAFLTRDDD
Download sequence
Identical sequences A0A1X9UAR3 A5VCY9
WP_012049994.1.69875 WP_012049994.1.83364 392499.Swit_3810 gi|148556711|ref|YP_001264293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]