SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5WG75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5WG75
Domain Number 1 Region: 29-233
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.78e-27
Family Bacterial lipase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5WG75
Sequence length 249
Comment (tr|A5WG75|A5WG75_PSYWF) Uncharacterized protein {ECO:0000313|EMBL:ABQ94666.1} KW=Complete proteome; Reference proteome OX=349106 OS=Psychrobacter sp. (strain PRwf-1). GN=PsycPRwf_1726 OC=Moraxellaceae; Psychrobacter.
Sequence
MLKLPLPNIVPLKKPDKPHKLSHKLMTHGDSERPFVVLIHGLHQKDWIMTPLAKQLQNRG
FATHQHNYHSLRERIDQHSKRLNQWLTEHHNPAIAIHLVGHSLGGLVIRDFVARYPHWKI
GRCVTLGTPHNGSTTAKYMSTLAAPLVGHSFKNALDGQSAPWPKSISLGVIAGDAPYGLG
QLVLNYHNQKVNLSQPQSAHDGTVYVFETQLNEATDHIIMPVSHTGMLINPKVAEQTAYF
LDHGYFKRR
Download sequence
Identical sequences A5WG75
349106.PsycPRwf_1726 WP_011960943.1.63326 gi|148653523|ref|YP_001280616.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]