SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5WGV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5WGV5
Domain Number 1 Region: 9-334
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.18e-37
Family Haloperoxidase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5WGV5
Sequence length 335
Comment (tr|A5WGV5|A5WGV5_PSYWF) Alpha/beta hydrolase fold protein {ECO:0000313|EMBL:ABQ94896.1} KW=Complete proteome; Reference proteome OX=349106 OS=Psychrobacter sp. (strain PRwf-1). GN=PsycPRwf_1956 OC=Moraxellaceae; Psychrobacter.
Sequence
MIHQTLNLVTTADHQQIAVWKITDNEAIKNPLNPSIGNHKRQNLLLLHGAFSDKGVCLGI
ASYFASLGYPCFIMEWRGHGSSSQPKTPYHLEDIAFYDVRATLDYLVNELNLDNLHCITH
SGGGICLTMLLTRHTEYVDKISSITLFACQAFAAATTPVSYAKLLLSKAATRQMGIVRGK
RLKLGTMNESYYLLSQWMDWNLNQNFSSYSPTPIRHQLKQAFNQRMHRLIDKRSGQGFQR
RHTAVIPQQPFDYRTVMPYITTPTYAICAAGDSVAPPQGCLKFLQAFNNANNHFREFGIA
SGDLENYNHTRIFLSRNAAAEVWPTVLNWIEKHSR
Download sequence
Identical sequences A5WGV5
WP_011961170.1.63326 gi|148653753|ref|YP_001280846.1| 349106.PsycPRwf_1956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]