SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5WVS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5WVS7
Domain Number 1 Region: 168-241
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.99e-25
Family PHD domain 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A5WVS7
Sequence length 242
Comment (tr|A5WVS7|A5WVS7_DANRE) Inhibitor of growth protein {ECO:0000256|RuleBase:RU361213} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=LOC792168 OC=Cyprinidae; Danio.
Sequence
MATAIYLEHYLDSIENLPCELQRNFTLMRELDNRAEEKKCEIDKLAEEYIANVRNLAPDQ
RVEHLQKIQNGFSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLDVSGY
ESPDNRTHKKVTGRGNLKEKRRPKGRGRKSSDDESPRKKKMKNSPEFPESILPVHPSDVL
DMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCTQDRK
KK
Download sequence
Identical sequences A5WVS7
7955.ENSDARP00000034139 ENSDARP00000040700 ENSDARP00000040700 NP_001093519.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]