SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5YBU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5YBU9
Domain Number 1 Region: 474-755
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.37e-60
Family Eukaryotic proteases 0.000000000949
Further Details:      
 
Domain Number 2 Region: 202-471
Classification Level Classification E-value
Superfamily vWA-like 1.13e-54
Family Integrin A (or I) domain 0.0000000225
Further Details:      
 
Domain Number 3 Region: 164-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000806
Family Complement control module/SCR domain 0.0000361
Further Details:      
 
Domain Number 4 Region: 97-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000553
Family Complement control module/SCR domain 0.0000436
Further Details:      
 
Domain Number 5 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000361
Family Complement control module/SCR domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A5YBU9
Sequence length 761
Comment (tr|A5YBU9|A5YBU9_SHEEP) Complement factor B {ECO:0000313|EMBL:ABR01165.1} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=C2 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MRIGHNPRLCLVPLILGLLCGGVGMTPLPEAGPQSPCSLEGVEIKGGSFRLLKAGQVLEY
LCPSGFYPYPVQIRTCRSTGSWSTLQTQDRKIVKRAECKAIRCPRPQDFENGEYWPRAAY
YNLSDEISFRCYDGYTFRGSANRTCLGNGRWDGETAICDDGAGYCPNPGIPLGTRKVGSQ
YRLEDRVTYYCNRGLTLRGSQQRTCQEGGSWSGTEPSCQDSFMYDTPAEVAEAFLSSLTE
TIEGVDAEDGHSPGEQQKRKIVLDPSGSMNIYLVLDGSDSVGAHNFTGAKNCLRDFIEKV
ASYGVKPKYGLVTYATEPKVLIKVFDPKSSEADWVTEQLNRINYADHKLKAGTNTKRALL
EVYNMMSRDINNLKETWNRTRHVIIIMTDGLHNMGGDPVTVIHDIRYLLDIGRNRKNPRE
DYLDIYVFGVGPLVNQENINALASKKDKEQHVFKLQGMENLEDVFVQMLDESRTLGLCGM
VWEHKDGTPYHKQPWHAKISVIRPSKGHESCMGAIVSEYFVLTAAHCFTVDDEKHSIKVS
VGGKRQEWEVEEVLFHPNYNLNAKKAKGIPEFYDYDVALIKLTKKLKYETTIRPICLPCT
EGSIQALRLPRSTTCQQQMQELLPAKDIEALFVSESKKTLTRKAVYIKNGDKKASCERDA
LHAPGYDKVKDVSEVVTPRFLCTGGVAPYADPNTCKGDSGGPLIIHKRSRFIQVGVISWG
VVDVCKRPQQVPGYARDFHINLYHVLPWLKEKLKNEDLGFL
Download sequence
Identical sequences A5YBU9
ENSOARP00000003145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]