SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6H7I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6H7I8
Domain Number 1 Region: 375-570
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.26e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0037
Further Details:      
 
Domain Number 2 Region: 546-654
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.62e-25
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6H7I8
Sequence length 692
Comment (sp|A6H7I8|TBC14_BOVIN) TBC1 domain family member 14 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TBC1D14; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTDGNLSTSTNGVALMGILDSRPGNHIQNLQHLTLKAPRSLSLPEYGPKLKLSALEDRHS
LQSVDSGIPTLEIGNPEPVPCSVVHVRRKPSESEIVPERACQSACLLPSYAPPAPAGAER
EQSVRKSSTFPRTGYDSVKLYSPASQTLQRSDNVSVCSVSSLSTELSTTLSVSNEDILDL
VVTSSSSAIVTLENDDDPQFTDVTLSSTRETRDLQRDCAGETEEGRKLRLLGPFSHFFTR
NSLARKQNARLDKQSDLGWKLFGKVPLGENAQKDAKKLQKEYEDKAGRPSKPPSPKQNVR
KNLDFEPLSTTALILEDRPANLPAKPAEEAQKHRQQYEEMVVQAKKRELKEAQRRKKQLE
ERCRLEESIGNAVLTWNNEILPNWETMWCSRKVRDLWWQGIPPSVRGKVWSLAIGNELNI
THELFDICLARAKERWRSFSTGGSEAETEDAGFSAADREASLELIKLDISRTFPSLCIFQ
QGGPYHDMLHSVLGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMA
FFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLAC
RVWDVFCRDGEEFLFRTALGLLRLFQDVLTRMDFIHVAQFLTRLPEDLPAEEFFASIASI
QMQSRNKKWAQVLTALQKDSREMEKGSPSLRH
Download sequence
Identical sequences A6H7I8
ENSBTAP00000039183 XP_005208403.1.76553 ENSBTAP00000039183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]