SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6LSR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6LSR9
Domain Number 1 Region: 309-460
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.37e-31
Family HD domain 0.014
Further Details:      
 
Domain Number 2 Region: 201-297
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.85e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6LSR9
Sequence length 513
Comment (sp|A6LSR9|RNY_CLOB8) Ribonuclease Y {ECO:0000255|HAMAP-Rule:MF_00335} KW=Complete proteome; Reference proteome OX=290402 OS=acetobutylicum). GN=Cbei_1217; OC=Clostridium.
Sequence
MVTAVMILIDVIVLLILGIVVYKTIQNISKAKIESLEKEAEEILVRAKKDAEATKKEAIL
EAKEELHKLRNDFDKESRERRNEIQRLERRVIQREEALDKKSELLEKKDETINQRMLEVD
QVEARVQKLYEERRAELERISALSSEEAREILLDEIRKEITHDAALMIKDIESKAKEEAD
KRAREVITTAIQRCAADHVSESTVHVVALPNDEMKGRIIGREGRNIRTLETLTGVDLIID
DTPEAVILSSFDPIRREVARMALEKLIVDGRIHPARIEEMVERATKDVESSIKEEGEQAA
LETSVHGLHPEIIRLLGRLKYRTSYGQNVLKHSIEVSYLAGLMASELGLDVTLAKRAGLL
HDIGKAVDQEQEGPHALIGGDLAKKYHESPLVINAIAAHHSDVEMQSLEAVLVQAADAIS
AARPGARRETLEAYIKRLEKLEEIANSHEGVEKSYAIQAGREIRIMVKPDKVDDAGTIEL
ARNLVKSVEEELEYPGQIKINVIRETRAVDFAK
Download sequence
Identical sequences A0A1S8P3R4 A0A202D165 A6LSR9
290402.Cbei_1217 WP_011968554.1.1793 WP_011968554.1.44456 gi|150016101|ref|YP_001308355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]