SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6LXS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6LXS7
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.28e-52
Family ROO N-terminal domain-like 0.000000453
Further Details:      
 
Domain Number 2 Region: 249-393
Classification Level Classification E-value
Superfamily Flavoproteins 3.84e-39
Family Flavodoxin-related 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6LXS7
Sequence length 396
Comment (tr|A6LXS7|A6LXS7_CLOB8) Beta-lactamase domain protein {ECO:0000313|EMBL:ABR35157.1} KW=Complete proteome; Reference proteome OX=290402 OS=acetobutylicum). GN=Cbei_3018 OC=Clostridium.
Sequence
MKELRDGVYWVGATDWKVRHIHGNELSTHRGSTYNSYLIKDEKTVLIDTVWEPLTEMFLE
NLREVTDISKIDYVVMNHGEPDHSGALPALMEHIPNATVFVSKKGLESIQKHYHKEWNFK
VVSTGEKINIGKNNLVFIEAPMLHWPDSMFTYLTGENILFSNDAFGQHYASSSIFNDEVD
ETEVNQEALKYYANILTPFSKLVTKKIDELKKLGVPVDMIAPAHGIIWRKDPMMIVEKYY
EWSAGKSNKSVVVAYNSMWGATHKMAEFIGKGLGEAGVEYKIFNVATSDKSDILAEVFKS
KGIILGSSTVNSGILTSLLPLIEDLIGLKFNEKVGAAFGSYGWGGESTDILTNYLTKAKI
KVVEDGLKFKYMPNDDELEECIAFGKNFGQKVLEEF
Download sequence
Identical sequences A6LXS7
gi|150017859|ref|YP_001310113.1| WP_012059210.1.44456 WP_012059210.1.51202 WP_012059210.1.88565 WP_012059210.1.91641 290402.Cbei_3018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]