SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6MYU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6MYU9
Domain Number 1 Region: 115-198
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000016
Family Caspase recruitment domain, CARD 0.018
Further Details:      
 
Domain Number 2 Region: 6-87
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000198
Family Pyrin domain, PYD 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6MYU9
Sequence length 201
Comment (tr|A6MYU9|A6MYU9_SINCH) ASC {ECO:0000313|EMBL:ABR24505.1} OX=119488 OS=Siniperca chuatsi (Mandarin fish). GN= OC=Eupercaria; Centrarchiformes; Centrarchoidei; Sinipercidae; Siniperca.
Sequence
MPPQTIRKALADMLEDLSQLDFEKFCRQLLDRREEQRVRRSRVESKSFLDIADVLVSTFG
EPNALQVAVEVLRQIDCNLDADRLVEETSALLSKSGSSDTARPSAGATGVNIMADDIHFV
DKHRTALISRVSNIAPILDELVDKNVIQQESYDRIRILPTTQEKMRELYSGCLKASGTCK
DIFYKILEENEKYLIADLKNK
Download sequence
Identical sequences A6MYU9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]