SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6N8P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6N8P9
Domain Number 1 Region: 30-117
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.82e-21
Family Acetylcholinesterase-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6N8P9
Sequence length 118
Comment (tr|A6N8P9|A6N8P9_CHICK) Acetylcholinesterase E1a {ECO:0000313|EMBL:ABR19825.1} OX=9031 OS=Gallus gallus (Chicken). GN=ACHE OC=Phasianidae; Phasianinae; Gallus.
Sequence
MAPLFLLLLLLLSPSPTSAHPDFAYSAPNRPEVRTTTGSVRGLLIPAGPSGSTAAAFLGI
PFAVPPLGPLRFRPPLPIPTPWTGIRDADSQPFACYQMVDTTFPGFQGSEMWNPNREM
Download sequence
Identical sequences A6N8P9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]