SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6NL66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A6NL66
Domain Number - Region: 149-188
Classification Level Classification E-value
Superfamily RNI-like 0.0051
Family 28-residue LRR 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6NL66
Sequence length 192
Comment (tr|A6NL66|A6NL66_HUMAN) Leucine-rich repeat-containing protein 42 {ECO:0000313|Ensembl:ENSP00000360419} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=LRRC42 OC=Catarrhini; Hominidae; Homo.
Sequence
MSYYLSSENHLDPGPIYMRENGQLHMVNLALDGVRSSLQKPRPFRLFPKGFSVELCMNRE
DDTARKEKTDHFIFTYTREGNLRYSAKSLFSLVLGFISDNVDHIDSLIGFPEQIAEKLFS
AAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLRNRYLVISEKLEEIKSFRELTCLDL
SCCKLGDEHELL
Download sequence
Identical sequences A6NL66
ENSP00000360419 ENSP00000360419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]