SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6QNR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6QNR4
Domain Number 1 Region: 157-260,303-574
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.86e-146
Family Myotubularin-like phosphatases 0.0000000625
Further Details:      
 
Domain Number 2 Region: 50-132
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000191
Family GRAM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6QNR4
Sequence length 1127
Comment (tr|A6QNR4|A6QNR4_BOVIN) Myotubularin related protein 4 {ECO:0000313|Ensembl:ENSBTAP00000030174} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=MTMR4 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MGEEGPPSLEYIQAKDLFPHKELVKEEENLQVPFTVLQGEGVEFLGRAADALIAISNYRL
HIKFKDSVINVPLRMIDSVESRDMFQLHIACKDSKVVRCHFSTFKQCQEWLSRLSRATAR
PAKPEDLFAFAYHAWCLGLTEEDQHAHLCQPGEHVRCRQEAELARMGFDLQNVWRVSHIN
SNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNGAAIARCSQPEISW
WGWRNADDEYLVTSIAKACALDPGPRTSGGSLSTGSSEASEACDTDFDSSLTACSGVESS
TAAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANIHAIRNSFQYLRAV
CSQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVA
LAKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENAEDQNEQCPVFLQWLDSVHQ
LLKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKRTCSVWALLRAGNK
NFHNFLYTPGSEMVLHPVCHVRALHLWTAVYLPASSPCTLGEESMDLYLSPVTQSQEFSG
RSLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQEARAGLEPWHGNPEASQTAFV
ESGAGGPQQAIGEMAGPPSLPSSQKDYLSNKPFKSHRNGSPGYKPLGATVPQETKSSTSE
PETKALTETQAPAPGPPAQDELDRTSDGTEEPPERCPEKAAIHTLSKVVSDKREGTGDFP
ESSQNPLPGALQQAQLDSLLGMPSRRAPDHGLGTLCNPPSATYQTPPNPSAYVPNQDPPG
CAASVANQEPPSSVLDTIHGEEDTGKRGNHRNGQLLENPRLGKVPLELARKPISQSQISE
FSFLGSNWDSFHGMVTSLPSGETTPRRLLSYGCCSKRASSKQTRAPGPCFGGQWAQREGV
KSPVCSSHSNGHCTGPGGKNNRMWLSGHPKQVPSMKPVALSCPSPVPPLYLDDDGLPFPT
DVIQHRLRQIEAGYKQEVEQLRRQVRELQMRLDIRHCCAPPAEPPMDYEDDFTCLKESDG
SDTEDFGSDHSDDCLSEASWEPVDKKETEDAFLAAVLLEFFLLPSVR
Download sequence
Identical sequences A6QNR4
NP_001095798.1.59421 NP_001095798.1.76553 ENSBTAP00000030174 ENSBTAP00000030174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]