SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6QNR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6QNR7
Domain Number 1 Region: 34-329
Classification Level Classification E-value
Superfamily L domain-like 8.5e-56
Family Ngr ectodomain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6QNR7
Sequence length 536
Comment (tr|A6QNR7|A6QNR7_BOVIN) Leucine rich repeat transmembrane neuronal 3 {ECO:0000313|Ensembl:ENSBTAP00000022459} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LRRTM3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MGFNVIRLLSGSAVALVIAPTVLLTMLSSAERGCPKGCRCEGKMVYCESQKLQEIPSSIS
AGCLGLSLRYNSLQKLKYNQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNR
ISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDC
RNLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYLQWNK
ISVIGQTMSWTWSSLQRLDLSGNEIEAFSGPSVFQCVPNLQRLNLDSNKLTFIGQEILDS
WISLNDISLAGNIWECSRNICSLVNWLKSFKGLRENTIICASPKELQGVNVIDAVKNYSI
CGKSTTERFDLARALPKPTFKPKLPRPKHESKPPLPPTVGATEPGPETDADTEHISFHKI
IAGSVALFLSVLVILLVIYVSWKRYPASMKQLQQRSLMRRHRKKKRQSLKQMTPSTQEFY
VDYKPTNTETSEMLLNGTGPCTYNKSGSRECEDCPKIIHTLPTQGFSNQIYFSSPY
Download sequence
Identical sequences A6QNR7
NP_001096753.1.59421 NP_001096753.1.76553 ENSBTAP00000022459 ENSBTAP00000022459 9913.ENSBTAP00000022459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]