SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6QP07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6QP07
Domain Number 1 Region: 500-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-27
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 556-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-26
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.03e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 306-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 600-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-22
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 463-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000105
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 8 Region: 40-84
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000209
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 
Domain Number 9 Region: 253-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000922
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6QP07
Sequence length 663
Comment (tr|A6QP07|A6QP07_BOVIN) Zinc finger protein 180 {ECO:0000313|Ensembl:ENSBTAP00000051468} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF180 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MEEQDEKPQGSLKVCVQDSLLPQEIIIKVEGEDARSLAVPSQEGVNFKIVTVDFTQEEEG
TLSSAQRTLDRDVILENHGDSWDLATALGRRESRLKQSVFDDKLSHSVKIEKLTRDDPWL
SSCKEFQDCKELLEKQQEKQERLLKEVTFTHRNAITHERDCKNDSPEEKAGLNSNLLSSQ
MIPIRNHFHKHASHVKKLHYNSMVNTHQMITDTEKLCENNEFGNLPQSIHFIQFTRTQTE
DKSYGFSDSIQPFNHGTPLNIHEKTHAQGRSFDFKECGQILNHSISHNEQQRNSIGESQY
KCHKTSQSSSLAQNMRNHSEEKPFECNQCGKSFSWSSHLVAHQRTHTGEKPYECNECGKS
FSRSSHLVSHQRTHTGEKPYRCNQCGKSFSQSYVLVVHQRTHTGEKPYECNQCGKSFRQS
YKLIAHQRTHTGEKPYECNQCGKSFIQSYKLIAHQRIHTGEKPYECNQCGKSFSQSYKLV
AHQRTHTGEKPFECNQCGKSFSWSSQLVAHQRTHTGEKPYECNECGKSFNRSSHLVMHQR
THTGEKPYECNQCGKSFSQSYVLVVHQRTHTGEKPYECSECGKSFRQSSCLTQHQRTHTG
EKPYECNQCGKTFSLSARLIVHQRTHTGEKPFTCNQCGKAFINSSKLIRHQATHTEEKPY
GCN
Download sequence
Identical sequences A6QP07
ENSBTAP00000051468 NP_001069112.2.59421 NP_001069112.2.76553 XP_015313646.1.76553 ENSBTAP00000051468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]