SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6QPJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6QPJ6
Domain Number 1 Region: 23-144
Classification Level Classification E-value
Superfamily FKBP-like 8.05e-34
Family FKBP immunophilin/proline isomerase 0.0002
Further Details:      
 
Domain Number 2 Region: 147-213
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000642
Family Calbindin D9K 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6QPJ6
Sequence length 218
Comment (tr|A6QPJ6|A6QPJ6_BOVIN) Peptidylprolyl isomerase {ECO:0000256|PROSITE-ProRule:PRU00277} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=FKBP7 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MHFLFRLILFFYVWGIFTAQGQKAEETTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGFL
AKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIGMMDMCPGEKRKLIIPPSFAYGKEGY
AEGKIPPDATLIFEIELYAVTKGPRSVETFKQIDTDNDRQLSKTEISHYLKKEFEKDEKP
RDQSYQTAVLEDFFKKNDHDGDGFISSKEYNVYQHDEL
Download sequence
Identical sequences A6QPJ6
ENSBTAP00000001452 NP_001093800.1.59421 NP_001093800.1.76553 XP_019825639.1.53367 ENSBTAP00000001452 9913.ENSBTAP00000001452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]