SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6QQQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6QQQ1
Domain Number 1 Region: 18-159
Classification Level Classification E-value
Superfamily EF-hand 1.39e-28
Family Calmodulin-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6QQQ1
Sequence length 164
Comment (tr|A6QQQ1|A6QQQ1_BOVIN) EFCAB2 protein {ECO:0000313|EMBL:AAI49944.1} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=EFCAB2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MADDRDRDSTEVAVAEFHKKIKEAFEVFDHESNNTVDVREVGTIIRSLGCCPSEGELHDL
IAEVEEEEPTGYIRFEKFLPVMTEVLLERRYRPIPEDILLRAFEVLDPAKRGFLSKDELI
KYMTEEGEPFSQEEMEEMLSAAIDPESNSIHYKDYITMMVIDEN
Download sequence
Identical sequences A6QQQ1
NP_001094717.1.59421 NP_001094717.1.76553 XP_005216900.1.76553 ENSBTAP00000034078 ENSBTAP00000034078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]