SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6UQK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6UQK4
Domain Number 1 Region: 5-252
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.22e-126
Family Methyl-coenzyme M reductase gamma chain 0.000000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6UQK4
Sequence length 260
Comment (tr|A6UQK4|A6UQK4_METVS) Methyl-coenzyme M reductase subunit gamma {ECO:0000256|PIRNR:PIRNR000264} KW=Complete proteome OX=406327 OS=OCM 148 / SB). GN=Mevan_0871 OC=Methanococcaceae; Methanococcus.
Sequence
MAYKPQFYPGATKVAENRRNHLNPNYELEKLREIPDEDVVKIMGHRQPGEDYKTVHPPLE
EMDMPADYVRDLVEPLNGAKEGHRVRYIQFADSMYFAPAQPYDRSRLYMIRLRGVDAGTL
SGRQVVECRESDLEEFSKNLLMDTELFDPATSGVRGATVHGHSLRLDENGMMFDALQRCV
FDEKTGHVMYVKDQVGKPLDQPVDVGEPMPEAKLREITTIYRKDGIAMRTDPEVIEVVKR
IHRARTLGGYIPTNEIFKGL
Download sequence
Identical sequences A6UQK4 P07963
gi|150399621|ref|YP_001323388.1| 406327.Mevan_0871 WP_011972677.1.66029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]